Loja
Showing 209881–209940 of 216899 results
-
Fmoc-Thr[GalNAc(Ac)3-?-D]-OH >98%, 25mg, ChemScene, #CS-6902-25mg (CAS: 116783-35-8)
Add to cart -
Peptide 401 >98%, 500ug, ChemScene, #CS-7079-500ug (CAS: 32908-73-9)
Add to cart -
{Val1}-Exendin-3/4 >98%, 1mg, ChemScene, #CS-8037-1mg
Add to cart -
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS >98%, 1mg, ChemScene, #CS-8039-1mg
Add to cart -
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS >98%, 1mg, ChemScene, #CS-8051-1mg
Add to cart -
Exendin-3/4 (59-86) >98%, 1mg, ChemScene, #CS-8060-1mg
Add to cart -
NIM811 >98%, 1mg, ChemScene, #CS-8062-1mg (CAS: 143205-42-9)
Add to cart -
Rhod-2 AM >98%, 1mg, ChemScene, #CS-8100-1mg (CAS: 145037-81-6)
Add to cart -
(4-Methylthiazol-2-yl)methanamine hydrochloride >98%, 100mg, ChemScene, #CS-B1096-100mg (CAS: 1196146-15-2)
Add to cart -
Byakangelicol >98%, 10mg, ChemScene, #CS-0007116-10mg (CAS: 26091-79-2)
Add to cart -
Deacetylasperulosidic Acid >98%, 10mg, ChemScene, #CS-0009604-10mg (CAS: 14259-55-3)
Add to cart -
Corypalmine >98%, 10mg, ChemScene, #CS-0009677-10mg (CAS: 27313-86-6)
Add to cart -
Trimethyl orthobenzoate >98%, 500g, ChemScene, #CS-0011453-500g (CAS: 707-07-3)
Add to cart -
MMAF (sodium) >98%, 5mg, ChemScene, #CS-0021397-5mg (CAS: 1799706-65-2)
Add to cart -
Flavokawain C >98%, 10mg, ChemScene, #CS-0022671-10mg (CAS: 37308-75-1)
Add to cart -
Kakuol >98%, 10mg, ChemScene, #CS-0022672-10mg (CAS: 18607-90-4)
Add to cart -
Decursinol >98%, 10mg, ChemScene, #CS-0032117-10mg (CAS: 23458-02-8)
Add to cart -
Beta-Eudesmol >98%, 10mg, ChemScene, #CS-0032182-10mg (CAS: 473-15-4)
Add to cart -
7-Bromo-2,3-dihydrobenzofuran-3-amine hydrochloride >98%, 250mg, ChemScene, #CS-0041438-250mg (CAS: 1258400-12-2)
Add to cart -
A 83-01 (sodium salt) >98%, 50mg, ChemScene, #CS-0043215-50mg
Add to cart -
Antennapedia Peptide(TFA) >98%, 5mg, ChemScene, #CS-0044148-5mg
Add to cart -
Methyl 2-bromo-5-methoxybenzoate >98%, 100g, ChemScene, #CS-0080148-100g (CAS: 35450-36-3)
Add to cart -
Neurokinin A(4-10) (TFA) >98%, 5mg, ChemScene, #CS-0092588-5mg
Add to cart -
6-Methoxybenzo[b]thiophene 1,1-dioxide >98%, 250mg, ChemScene, #CS-0093327-250mg (CAS: 98733-09-6)
Add to cart -
7-Bromo-5-methoxybenzo[d]thiazol-2-amine >98%, 250mg, ChemScene, #CS-0095284-250mg (CAS: 1998062-49-9)
Add to cart -
Rotigotine >98%, 50mg, ChemScene, #CS-0376-50mg (CAS: 99755-59-6)
Add to cart -
TMC353121 >98%, 10mg, ChemScene, #CS-0682-10mg (CAS: 857066-90-1)
Add to cart -
CH5132799 >98%, 10mg, ChemScene, #CS-0981-10mg (CAS: 1007207-67-1)
Add to cart -
NG 52 >98%, 10mg, ChemScene, #CS-1187-10mg (CAS: 212779-48-1)
Add to cart -
PP1 >98%, 50mg, ChemScene, #CS-1662-50mg (CAS: 172889-26-8)
Add to cart -
MMAF (Hydrochloride) >98%, 5mg, ChemScene, #CS-3105-5mg (CAS: 1415246-68-2)
Add to cart -
Tebipenem >98%, 10mg, ChemScene, #CS-3444-10mg (CAS: 161715-21-5)
Add to cart -
PD173955 >98%, 10mg, ChemScene, #CS-3550-10mg (CAS: 260415-63-2)
Add to cart -
ICA-121431 >98%, 50mg, ChemScene, #CS-4061-50mg (CAS: 313254-51-2)
Add to cart -
Iotalamic acid >98%, 10mg, ChemScene, #CS-4575-10mg (CAS: 2276-90-6)
Add to cart -
Terutroban >98%, 50mg, ChemScene, #CS-4806-50mg (CAS: 165538-40-9)
Add to cart -
Pachymic acid >98%, 10mg, ChemScene, #CS-5368-10mg (CAS: 29070-92-6)
Add to cart -
Oleandrin >98%, 5mg, ChemScene, #CS-5505-5mg (CAS: 465-16-7)
Add to cart -
EL-102 >98%, 5mg, ChemScene, #CS-5641-5mg (CAS: 1233948-61-2)
Add to cart -
MK-0812 (Succinate) >98%, 10mg, ChemScene, #CS-5928-10mg (CAS: 851916-42-2)
Add to cart -
Amiselimod (hydrochloride) >98%, 5mg, ChemScene, #CS-5972-5mg (CAS: 942398-84-7)
Add to cart -
I-CBP112 >98%, 5mg, ChemScene, #CS-6146-5mg (CAS: 1640282-31-0)
Add to cart -
PGD2-IN-1 >98%, 10mg, ChemScene, #CS-6338-10mg (CAS: 885066-67-1)
Add to cart -
Emodepside >98%, 10mg, ChemScene, #CS-6406-10mg (CAS: 155030-63-0)
Add to cart -
Dihydroisotanshinone I >98%, 10mg, ChemScene, #CS-6505-10mg (CAS: 20958-18-3)
Add to cart -
Carcinoembryonic Antigen (CEA) >98%, 1mg, ChemScene, #CS-7026-1mg (CAS: 168635-85-6)
Add to cart -
Neuromedin B >98%, 5mg, ChemScene, #CS-7101-5mg (CAS: 87096-84-2)
Add to cart -
Nociceptin >98%, 5mg, ChemScene, #CS-7588-5mg (CAS: 170713-75-4)
Add to cart -
NFAT Inhibitor >98%, 5mg, ChemScene, #CS-7593-5mg (CAS: 249537-73-3)
Add to cart -
IDH-305 >98%, 5mg, ChemScene, #CS-8084-5mg (CAS: 1628805-46-8)
Add to cart -
rel-(1R,2S)-2-((tert-butoxycarbonyl)amino)cyclopropane-1-carboxylic acid >98%, 1g, ChemScene, #CS-B1338-1g (CAS: 1810070-30-4)
Add to cart -
Methyl 5-hydroxypyrazine-2-carboxylate >98%, 25g, ChemScene, #CS-M3260-25g (CAS: 13924-95-3)
Add to cart -
3,5-Difluoro-2-hydroxybenzaldehyde >98%, 5g, ChemScene, #CS-W017964-5g (CAS: 63954-77-8)
Add to cart -
Ovalbumin, purified, 25g, Bio Basic, #A605084-0025, CAS: [9006-59-1]
Add to cart -
Methyl 5-(hydroxymethyl)pyrazolo[1,5-a]pyridine-3-carboxylate >98%, 250mg, ChemScene, #CS-0083838-250mg (CAS: 474432-56-9)
Add to cart -
Diiodo(p-cymene)ruthenium(II) dimer >98%, 5g, ChemScene, #CS-M3206-5g (CAS: 90614-07-6)
Add to cart -
5-Bromothiazole-2-carboxylic acid >98%, 1g, ChemScene, #CS-W022341-1g (CAS: 957346-62-2)
Add to cart -
tert-Butyl N-[(1S)-3-oxocyclopentyl]carbamate >98%, 250mg, ChemScene, #CS-0048034-250mg (CAS: 167298-40-0)
Add to cart -
tert-Butyl N-[(1R)-3-oxocyclopentyl]carbamate >98%, 250mg, ChemScene, #CS-0048043-250mg (CAS: 225641-86-1)
Add to cart -
7-Methoxy-1,2,3,4-tetrahydroquinazoline-2,4-dione >98%, 5g, ChemScene, #CS-0050012-5g (CAS: 62484-12-2)
Add to cart