Reagentes
Showing 156301–156360 of 163340 results
-
5,6,7,8-Tetrahydro-?,5,5,8,8-pentamethyl-2-naphthalenemethanol >98%, 1g, ChemScene, #CS-B1782-1g (CAS: 69251-25-8)
Add to cart -
(S)-2-amino-3-cyclopentyl-N-cyclopropylpropanamide hydrochloride >98%, 100mg, ChemScene, #CS-M2873-100mg (CAS: 1404457-08-4)
Add to cart -
(S)-2-Amino-2-(3-trifluoromethylphenyl)ethanol >98%, 250mg, ChemScene, #CS-0041049-250mg (CAS: 325152-99-6)
Add to cart -
2-(5-Methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)acetic acid >98%, 5g, ChemScene, #CS-0042820-5g (CAS: 345637-71-0)
Add to cart -
2-Amino-6,7,8,9-tetrahydro-5H-benzo[7]annulen-5-one >98%, 250mg, ChemScene, #CS-0043394-250mg (CAS: 3470-55-1)
Add to cart -
6-Bromo-2-(2-(3-methoxyphenyl)propan-2-yl)benzofuran-3-carboxylic acid >98%, 250mg, ChemScene, #CS-0081811-250mg (CAS: 2095616-86-5)
Add to cart -
(2S,4S)-2,4-Bis(diphenylphosphino)pentane >98%, 1g, ChemScene, #CS-0086027-1g (CAS: 77876-39-2)
Add to cart -
(11bR)-N,N-bis((R)-1-phenylethyl)-8,9,10,11,12,13,14,15-octahydrodinaphtho[2,1-d:1′,2′-f][1,3,2]dioxaphosphepin-4-amine >98%, 250mg, ChemScene, #CS-0087683-250mg (CAS: 1389329-66-1)
Add to cart -
(11bS)-8,9,10,11,12,13,14,15-Octahydro-N,N-bis[(1R)-1-phenylethyl]-dinaphtho[2,1-d:1′,2′-f][1,3,2]dioxaphosphepin-4-amine >98%, 250mg, ChemScene, #CS-0087692-250mg (CAS: 479413-76-8)
Add to cart -
2,2-Difluoropropane-1,3-diol >98%, 5g, ChemScene, #CS-0094694-5g (CAS: 428-63-7)
Add to cart -
3-Aminoquinolin-2(1H)-one >98%, 250mg, ChemScene, #CS-0099008-250mg (CAS: 5873-00-7)
Add to cart -
2-Methyl-5-oxo-2,5-dihydro-1H-pyrazole-3-carboxylic acid >98%, 250mg, ChemScene, #CS-0101609-250mg (CAS: 58365-04-1)
Add to cart -
Tris(4,7-diphenyl-1,10-phenanthroline)ruthenium(II) dichloride >98%, 1g, ChemScene, #CS-0110171-1g (CAS: 36309-88-3)
Add to cart -
1-(Cyclopropylmethyl)piperidin-4-one >98%, 1g, ChemScene, #CS-0113144-1g (CAS: 49682-96-4)
Add to cart -
1,3-dibromo-1,3,5-triazinane-2,4,6-trione >98%, 100g, ChemScene, #CS-0130478-100g (CAS: 15114-43-9)
Add to cart -
2′-Deoxyguanosine >98%, 100g, ChemScene, #CS-3151-100g (CAS: 961-07-9)
Add to cart -
tert-Butyl 3-bromo-5,6-dihydro-1,2,4-triazolo[4,3-a]pyrazine-7(8H)-carboxylate >98%, 5g, ChemScene, #CS-B1005-5g (CAS: 723286-80-4)
Add to cart -
4,6-dichloro-2-(propylthio)pyrimidin-5-amine >98%, 500g, ChemScene, #CS-M1848-500g (CAS: 145783-15-9)
Add to cart -
(S)-3-Amino-4-methylpentanoic acid >98%, 5g, ChemScene, #CS-W005787-5g (CAS: 40469-85-0)
Add to cart -
4-Bromo-2-fluoro-1-iodobenzene >98%, 1000g, ChemScene, #CS-W008638-1000g (CAS: 105931-73-5)
Add to cart -
6-Bromo-5-fluoro-1H-indazole >98%, 5g, ChemScene, #CS-W022464-5g (CAS: 1286734-85-7)
Add to cart -
Ginsenoside Rg5 >98%, 5mg, ChemScene, #CS-3850-5mg (CAS: 186763-78-0)
Add to cart -
Macitentan (n-butyl analogue) >98%, 10mg, ChemScene, #CS-4044-10mg (CAS: 556797-16-1)
Add to cart -
Nesiritide >98%, 1mg, ChemScene, #CS-5976-1mg (CAS: 124584-08-3)
Add to cart -
ABT-072 >98%, 1mg, ChemScene, #CS-6791-1mg (CAS: 1132936-00-5)
Add to cart -
Fmoc-Thr[GalNAc(Ac)3-?-D]-OH >98%, 25mg, ChemScene, #CS-6902-25mg (CAS: 116783-35-8)
Add to cart -
Peptide 401 >98%, 500ug, ChemScene, #CS-7079-500ug (CAS: 32908-73-9)
Add to cart -
{Val1}-Exendin-3/4 >98%, 1mg, ChemScene, #CS-8037-1mg
Add to cart -
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS >98%, 1mg, ChemScene, #CS-8039-1mg
Add to cart -
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS >98%, 1mg, ChemScene, #CS-8051-1mg
Add to cart -
Exendin-3/4 (59-86) >98%, 1mg, ChemScene, #CS-8060-1mg
Add to cart -
NIM811 >98%, 1mg, ChemScene, #CS-8062-1mg (CAS: 143205-42-9)
Add to cart -
Rhod-2 AM >98%, 1mg, ChemScene, #CS-8100-1mg (CAS: 145037-81-6)
Add to cart -
(4-Methylthiazol-2-yl)methanamine hydrochloride >98%, 100mg, ChemScene, #CS-B1096-100mg (CAS: 1196146-15-2)
Add to cart -
Byakangelicol >98%, 10mg, ChemScene, #CS-0007116-10mg (CAS: 26091-79-2)
Add to cart -
Deacetylasperulosidic Acid >98%, 10mg, ChemScene, #CS-0009604-10mg (CAS: 14259-55-3)
Add to cart -
Corypalmine >98%, 10mg, ChemScene, #CS-0009677-10mg (CAS: 27313-86-6)
Add to cart -
Trimethyl orthobenzoate >98%, 500g, ChemScene, #CS-0011453-500g (CAS: 707-07-3)
Add to cart -
MMAF (sodium) >98%, 5mg, ChemScene, #CS-0021397-5mg (CAS: 1799706-65-2)
Add to cart -
Flavokawain C >98%, 10mg, ChemScene, #CS-0022671-10mg (CAS: 37308-75-1)
Add to cart -
Kakuol >98%, 10mg, ChemScene, #CS-0022672-10mg (CAS: 18607-90-4)
Add to cart -
Decursinol >98%, 10mg, ChemScene, #CS-0032117-10mg (CAS: 23458-02-8)
Add to cart -
Beta-Eudesmol >98%, 10mg, ChemScene, #CS-0032182-10mg (CAS: 473-15-4)
Add to cart -
7-Bromo-2,3-dihydrobenzofuran-3-amine hydrochloride >98%, 250mg, ChemScene, #CS-0041438-250mg (CAS: 1258400-12-2)
Add to cart -
A 83-01 (sodium salt) >98%, 50mg, ChemScene, #CS-0043215-50mg
Add to cart -
Antennapedia Peptide(TFA) >98%, 5mg, ChemScene, #CS-0044148-5mg
Add to cart -
Methyl 2-bromo-5-methoxybenzoate >98%, 100g, ChemScene, #CS-0080148-100g (CAS: 35450-36-3)
Add to cart -
Neurokinin A(4-10) (TFA) >98%, 5mg, ChemScene, #CS-0092588-5mg
Add to cart -
6-Methoxybenzo[b]thiophene 1,1-dioxide >98%, 250mg, ChemScene, #CS-0093327-250mg (CAS: 98733-09-6)
Add to cart -
7-Bromo-5-methoxybenzo[d]thiazol-2-amine >98%, 250mg, ChemScene, #CS-0095284-250mg (CAS: 1998062-49-9)
Add to cart -
Rotigotine >98%, 50mg, ChemScene, #CS-0376-50mg (CAS: 99755-59-6)
Add to cart -
TMC353121 >98%, 10mg, ChemScene, #CS-0682-10mg (CAS: 857066-90-1)
Add to cart -
CH5132799 >98%, 10mg, ChemScene, #CS-0981-10mg (CAS: 1007207-67-1)
Add to cart -
NG 52 >98%, 10mg, ChemScene, #CS-1187-10mg (CAS: 212779-48-1)
Add to cart -
PP1 >98%, 50mg, ChemScene, #CS-1662-50mg (CAS: 172889-26-8)
Add to cart -
MMAF (Hydrochloride) >98%, 5mg, ChemScene, #CS-3105-5mg (CAS: 1415246-68-2)
Add to cart -
Tebipenem >98%, 10mg, ChemScene, #CS-3444-10mg (CAS: 161715-21-5)
Add to cart -
PD173955 >98%, 10mg, ChemScene, #CS-3550-10mg (CAS: 260415-63-2)
Add to cart -
ICA-121431 >98%, 50mg, ChemScene, #CS-4061-50mg (CAS: 313254-51-2)
Add to cart -
Iotalamic acid >98%, 10mg, ChemScene, #CS-4575-10mg (CAS: 2276-90-6)
Add to cart